MATN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16397T
Artikelname: MATN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16397T
Hersteller Artikelnummer: CNA16397T
Alternativnummer: MBL-CNA16397T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human MATN2 (NP_001304677.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 4147
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SDGRQDSPAGELPKTVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEEDNLLRSTQKLSHSTKPSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRLEEMTQRMEALENRLRYR
Target-Kategorie: MATN2
Application Verdünnung: WB: WB,1:500 - 1:2000