CAMP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1640P
Artikelname: CAMP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1640P
Hersteller Artikelnummer: CNA1640P
Alternativnummer: MBL-CNA1640P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human CAMP (NP_004336.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 820
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: IIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Target-Kategorie: CAMP
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200