PON3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16418T
Artikelname: PON3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16418T
Hersteller Artikelnummer: CNA16418T
Alternativnummer: MBL-CNA16418T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PON3 (NP_000931.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 5446
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTL
Target-Kategorie: PON3
Application Verdünnung: WB: WB,1:500 - 1:2000