PRSS8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16419T
Artikelname: PRSS8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16419T
Hersteller Artikelnummer: CNA16419T
Alternativnummer: MBL-CNA16419T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human PRSS8 (NP_002764.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 5652
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH
Target-Kategorie: PRSS8
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200