delta-Catenin/p120 Catenin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1641T
Artikelname: delta-Catenin/p120 Catenin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1641T
Hersteller Artikelnummer: CNA1641T
Alternativnummer: MBL-CNA1641T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 850-968 of human delta-Catenin/p120 Catenin (NP_001078927.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 108kDa
NCBI: 1500
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
Target-Kategorie: CTNND1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200