DGKZ Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16457T
Artikelname: DGKZ Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16457T
Hersteller Artikelnummer: CNA16457T
Alternativnummer: MBL-CNA16457T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 808-1117 of human DGKZ (NP_001099010.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 8525
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRT
Target-Kategorie: DGKZ
Application Verdünnung: WB: WB,1:500 - 1:2000