TNFSF12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16458T
Artikelname: TNFSF12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16458T
Hersteller Artikelnummer: CNA16458T
Alternativnummer: MBL-CNA16458T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-123 of human TNFSF12 (O43508).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 8742
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQ
Target-Kategorie: TNFSF12
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100