PARP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16475T
Artikelname: PARP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16475T
Hersteller Artikelnummer: CNA16475T
Alternativnummer: MBL-CNA16475T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PARP2 (NP_001036083.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 10038
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYN
Target-Kategorie: PARP2
Application Verdünnung: WB: WB,1:500 - 1:2000