ACHA4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1648S
Artikelname: ACHA4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1648S
Hersteller Artikelnummer: CNA1648S
Alternativnummer: MBL-CNA1648S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-242 of human ACHA4 (P43681).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 1137
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRL
Target-Kategorie: CHRNA4
Application Verdünnung: WB: WB,1:500 - 1:2000