FAM107A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA16493T
| Artikelname: |
FAM107A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA16493T |
| Hersteller Artikelnummer: |
CNA16493T |
| Alternativnummer: |
MBL-CNA16493T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human FAM107A (NP_009108.1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
17kDa |
| NCBI: |
11170 |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL |
| Target-Kategorie: |
FAM107A |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
