CAND2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16500T
Artikelname: CAND2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16500T
Hersteller Artikelnummer: CNA16500T
Alternativnummer: MBL-CNA16500T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 135kDa
NCBI: 23066
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISD
Target-Kategorie: CAND2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200