CTNNA3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16519T
Artikelname: CTNNA3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16519T
Hersteller Artikelnummer: CNA16519T
Alternativnummer: MBL-CNA16519T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human CTNNA3 (NP_001278062.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 100kDa
NCBI: 29119
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKSTQRREKQGSMSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREAVVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEH
Target-Kategorie: CTNNA3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200