CKLF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16528T
Artikelname: CKLF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16528T
Hersteller Artikelnummer: CNA16528T
Alternativnummer: MBL-CNA16528T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-67 of human CKLF (NP_057410.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 51192
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDNVQPKIKHRPFCFSVKGHVKMLRLVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL
Target-Kategorie: CKLF
Application Verdünnung: WB: WB,1:500 - 1:2000