SMN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1652S
Artikelname: SMN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1652S
Hersteller Artikelnummer: CNA1652S
Alternativnummer: MBL-CNA1652S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SMN2 (NP_059107.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 6607
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP
Target-Kategorie: SMN2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100