ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16539T
Artikelname: ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16539T
Hersteller Artikelnummer: CNA16539T
Alternativnummer: MBL-CNA16539T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ZCCHC10 (NP_001287745.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 54819
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA
Target-Kategorie: ZCCHC10
Application Verdünnung: WB: WB,1:500 - 1:2000