ZNF471 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16560T
Artikelname: ZNF471 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16560T
Hersteller Artikelnummer: CNA16560T
Alternativnummer: MBL-CNA16560T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 57573
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECSTFEENWKWEDLFEKQMGSHEMFSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMVIKHKKVYVGKKLFKCNE
Target-Kategorie: ZNF471
Application Verdünnung: WB: WB,1:500 - 1:2000