ELOVL5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16567T
Artikelname: ELOVL5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16567T
Hersteller Artikelnummer: CNA16567T
Alternativnummer: MBL-CNA16567T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human ELOVL5 (NP_001229757.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 60481
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Target-Kategorie: ELOVL5
Application Verdünnung: WB: WB,1:500 - 1:2000