HKDC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16573T
Artikelname: HKDC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16573T
Hersteller Artikelnummer: CNA16573T
Alternativnummer: MBL-CNA16573T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HKDC1 (NP_079406.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 80201
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEG
Target-Kategorie: HKDC1
Application Verdünnung: WB: WB,1:500 - 1:2000