KLHL15 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16574T
Artikelname: KLHL15 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16574T
Hersteller Artikelnummer: CNA16574T
Alternativnummer: MBL-CNA16574T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human KLHL15 (NP_085127.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 80311
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFCCSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKLMSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSEFYRYSRQLRYEVDQ
Target-Kategorie: KLHL15
Application Verdünnung: WB: WB,1:500 - 1:2000