STARD3NL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16579T
Artikelname: STARD3NL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16579T
Hersteller Artikelnummer: CNA16579T
Alternativnummer: MBL-CNA16579T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 185-234 of human STARD3NL (NP_114405.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 83930
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL
Target-Kategorie: STARD3NL
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200