Steroidogenic factor-1 (SF-1/NR5A1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1657T
Artikelname: Steroidogenic factor-1 (SF-1/NR5A1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1657T
Hersteller Artikelnummer: CNA1657T
Alternativnummer: MBL-CNA1657T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Steroidogenic factor-1 (SF-1/Steroidogenic factor-1 (SF-1/NR5A1)) (NP_004950.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 2516
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
Target-Kategorie: NR5A1
Application Verdünnung: WB: WB,1:500 - 1:1000