ARHGAP11B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16587T
Artikelname: ARHGAP11B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16587T
Hersteller Artikelnummer: CNA16587T
Alternativnummer: MBL-CNA16587T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 218-267 of human ARHGAP11B (NP_001034930.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 89839
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV
Target-Kategorie: ARHGAP11B
Application Verdünnung: WB: WB,1:100 - 1:500