CDCA5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16590T
Artikelname: CDCA5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16590T
Hersteller Artikelnummer: CNA16590T
Alternativnummer: MBL-CNA16590T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-150 of human CDCA5 (NP_542399.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 113130
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLE
Target-Kategorie: CDCA5
Application Verdünnung: WB: WB,1:500 - 1:2000