NRN1L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16594T
Artikelname: NRN1L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16594T
Hersteller Artikelnummer: CNA16594T
Alternativnummer: MBL-CNA16594T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 39-139 of human NRN1L (Q496H8).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 123904
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA
Target-Kategorie: NRN1L
Application Verdünnung: WB: WB,1:500 - 1:2000