SOGA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16597T
Artikelname: SOGA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16597T
Hersteller Artikelnummer: CNA16597T
Alternativnummer: MBL-CNA16597T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 160kDa
NCBI: 140710
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP
Target-Kategorie: SOGA1
Application Verdünnung: WB: WB,1:500 - 1:2000