SPC24 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16601P
Artikelname: SPC24 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16601P
Hersteller Artikelnummer: CNA16601P
Alternativnummer: MBL-CNA16601P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SPC24 (NP_872319.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 147841
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW
Target-Kategorie: SPC24
Application Verdünnung: WB: WB,1:1000 - 1:5000