NFAT5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16649T
Artikelname: NFAT5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16649T
Hersteller Artikelnummer: CNA16649T
Alternativnummer: MBL-CNA16649T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1300 to the C-terminus of human NFAT5 (NP_619728.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 166kDa
NCBI: 10725
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Target-Kategorie: NFAT5
Application Verdünnung: WB: WB,1:500 - 1:2000