AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16656T
Artikelname: AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16656T
Hersteller Artikelnummer: CNA16656T
Alternativnummer: MBL-CNA16656T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 515-574 of human AMPKalpha1 (NP_006242.5).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 5562
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Target-Kategorie: PRKAA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200