UGT2B15 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16657T
Artikelname: UGT2B15 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16657T
Hersteller Artikelnummer: CNA16657T
Alternativnummer: MBL-CNA16657T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human UGT2B15 (NP_001067.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 7366
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLF
Target-Kategorie: UGT2B15
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200