p70 S6 Kinase 1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16658T
Artikelname: p70 S6 Kinase 1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16658T
Hersteller Artikelnummer: CNA16658T
Alternativnummer: MBL-CNA16658T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-532 of human P70 S6K (NP_003152.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 6198
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Target-Kategorie: RPS6KB1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200