CD147/BSG Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16662T
Artikelname: CD147/BSG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16662T
Hersteller Artikelnummer: CNA16662T
Alternativnummer: MBL-CNA16662T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD147/CD147/BSG (NP_001719.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 682
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Target-Kategorie: BSG
Application Verdünnung: WB: WB,1:500 - 1:1000