CACNA1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16687T
Artikelname: CACNA1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16687T
Hersteller Artikelnummer: CNA16687T
Alternativnummer: MBL-CNA16687T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2200 to the C-terminus of human CACNA1B (NP_000709.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 262kDa
NCBI: 774
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRARHSYHHPDQDHWC
Target-Kategorie: CACNA1B
Application Verdünnung: WB: WB,1:500 - 1:2000