FXN / Frataxin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16688T
Artikelname: FXN / Frataxin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16688T
Hersteller Artikelnummer: CNA16688T
Alternativnummer: MBL-CNA16688T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-210 of human FXN / Frataxin (NP_000135.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 2395
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Target-Kategorie: FXN
Application Verdünnung: WB: WB,1:500 - 1:2000