FCN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16690T
Artikelname: FCN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16690T
Hersteller Artikelnummer: CNA16690T
Alternativnummer: MBL-CNA16690T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 230-290 of human FCN2 (NP_004099.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 2220
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANG
Target-Kategorie: FCN2
Application Verdünnung: WB: WB,1:500 - 1:2000