Neuropilin-1 (NRP1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16697P
Artikelname: Neuropilin-1 (NRP1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16697P
Hersteller Artikelnummer: CNA16697P
Alternativnummer: MBL-CNA16697P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Neuropilin-1 (NRP1) (NP_003864.5).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 8829
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: IDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA
Target-Kategorie: NRP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200