Collagen I/COL1A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16699S
Artikelname: Collagen I/COL1A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16699S
Hersteller Artikelnummer: CNA16699S
Alternativnummer: MBL-CNA16699S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen I/COL1A2 (NP_000080.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 129kDa
NCBI: 1278
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA
Target-Kategorie: COL1A2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200