RABGGTA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16726T
Artikelname: RABGGTA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16726T
Hersteller Artikelnummer: CNA16726T
Alternativnummer: MBL-CNA16726T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human RABGGTA (NP_878256.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 5875
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DPQDALRCLHVSRDEACLTVSFSRPLLVGSRMEILLLMVDDSPLIVEWRTPDGRNRPSHVWLCDLPAASLNDQLPQHTFRVIWTAGDVQKECVLLKGRQEGWCRDSTTDEQLFRCELSVEK
Target-Kategorie: RABGGTA
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200