NF-kB p65/RelA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16728T
Artikelname: NF-kB p65/RelA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16728T
Hersteller Artikelnummer: CNA16728T
Alternativnummer: MBL-CNA16728T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human NF-kB p65/RelA (NP_068810.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 5970
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS
Target-Kategorie: RELA
Application Verdünnung: WB: WB,1:500 - 1:2000