ABCA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16735T
Artikelname: ABCA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16735T
Hersteller Artikelnummer: CNA16735T
Alternativnummer: MBL-CNA16735T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-350 of human ABCA2 (NP_001597.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 270kDa
NCBI: 20
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SHLDRSTVSSFSLDSVARNPQELWRFLTQNLSLPNSTAQALLAARVDPPEVYHLLFGPSSALDSQSGLHKGQEPWSRLGGNPLFRMEELLLAPALLEQLTCTPGSGELGRILTVPESQKGALQGYRDAVCSGQAAARARRFSGLSAELRNQLDVAKVSQQLGLDAPNGSDSSPQAPPPRRLQALLGDLLDAQKVLQDVDVLSALALLLPQG
Target-Kategorie: ABCA2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200