BCKDHA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16774S
Artikelname: BCKDHA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16774S
Hersteller Artikelnummer: CNA16774S
Alternativnummer: MBL-CNA16774S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 276-445 of human BCKDHA (NP_000700.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 593
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK
Target-Kategorie: BCKDHA
Application Verdünnung: WB: WB,1:1000 - 1:5000