CACNA1D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16785T
Artikelname: CACNA1D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16785T
Hersteller Artikelnummer: CNA16785T
Alternativnummer: MBL-CNA16785T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1882-2181 of human CACNA1D (NP_000711.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 245kDa
NCBI: 776
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVRPRA
Target-Kategorie: CACNA1D
Application Verdünnung: WB: WB,1:500 - 1:2000