CCKAR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16799T
Artikelname: CCKAR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16799T
Hersteller Artikelnummer: CNA16799T
Alternativnummer: MBL-CNA16799T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CCKAR (NP_000721.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 886
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLL
Target-Kategorie: CCKAR
Application Verdünnung: WB: WB,1:500 - 1:2000