CD86 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16805P
Artikelname: CD86 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16805P
Hersteller Artikelnummer: CNA16805P
Alternativnummer: MBL-CNA16805P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-247 of human CD86 (NP_787058.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 942
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Target-Kategorie: CD86
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200