CD70 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16810T
Artikelname: CD70 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16810T
Hersteller Artikelnummer: CNA16810T
Alternativnummer: MBL-CNA16810T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 47-126 of human CD70 (NP_001243.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 970
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPT
Target-Kategorie: CD70
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200