CD52 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16815P
Artikelname: CD52 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16815P
Hersteller Artikelnummer: CNA16815P
Alternativnummer: MBL-CNA16815P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-61 of human CD52 (NP_001794.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 7kDa
NCBI: 1043
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Target-Kategorie: CD52
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100