CHRM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16819T
Artikelname: CHRM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16819T
Hersteller Artikelnummer: CNA16819T
Alternativnummer: MBL-CNA16819T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 264-340 of human CHRM1 (NP_000729.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 1128
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKG
Target-Kategorie: CHRM1
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200