COPA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16821T
Artikelname: COPA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16821T
Hersteller Artikelnummer: CNA16821T
Alternativnummer: MBL-CNA16821T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human COPA (NP_001091868.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 138kDa
NCBI: 1314
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHF
Target-Kategorie: COPA
Application Verdünnung: WB: WB,1:500 - 1:2000