DLG3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16831T
Artikelname: DLG3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16831T
Hersteller Artikelnummer: CNA16831T
Alternativnummer: MBL-CNA16831T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 464-817 of human DLG3 (NP_066943.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 1741
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGK
Target-Kategorie: DLG3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200