EGFR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16840T
Artikelname: EGFR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16840T
Hersteller Artikelnummer: CNA16840T
Alternativnummer: MBL-CNA16840T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 1956
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
Target-Kategorie: EGFR
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200