GNA15 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16866T
Artikelname: GNA15 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16866T
Hersteller Artikelnummer: CNA16866T
Alternativnummer: MBL-CNA16866T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 112-374 of human GNA15 (NP_002059.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 2769
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLA
Target-Kategorie: GNA15
Application Verdünnung: WB: WB,1:500 - 1:2000